PDB entry 2jhb

View 2jhb on RCSB PDB site
Description: core binding factor beta
Class: gene regulation
Keywords: core binding factor, transcription factor, gene regulation
Deposited on 1999-03-17, released 1999-07-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (core binding factor beta)
    Species: Mus musculus [TaxId:10090]
    Gene: CBFB141
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jhba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jhbA (A:)
    gsmprvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafv
    atgtnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhr
    ldgmgclefdeeraqqedalaqq