Class b: All beta proteins [48724] (174 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins) |
Protein N-terminal domain of NSF-N, NSF-Nn [50709] (2 species) NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains |
Species Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId:4932] [50711] (1 PDB entry) |
Domain d1cr5b1: 1cr5 B:23-107 [26932] Other proteins in same PDB: d1cr5a2, d1cr5b2, d1cr5c2 complexed with nen |
PDB Entry: 1cr5 (more details), 2.3 Å
SCOPe Domain Sequences for d1cr5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cr5b1 b.52.2.3 (B:23-107) N-terminal domain of NSF-N, NSF-Nn {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} dtrtrhlkvsncpnnsyalanvaavspndfpnniyiiidnlfvfttrhsndippgtigfn gnqrtwggwslnqdvqakafdlfky
Timeline for d1cr5b1:
View in 3D Domains from other chains: (mouse over for more information) d1cr5a1, d1cr5a2, d1cr5c1, d1cr5c2 |