SCOPe 2.01: Domain d1cr5b1: 1cr5 B:23-107

Lineage for d1cr5b1 (1cr5 B:23-107)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)

6. Protein N-terminal domain of NSF-N, NSF-Nn [50709] (2 species)
   NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains

7. Species Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId:4932] [50711] (1 PDB entry)

8. Domain d1cr5b1: 1cr5 B:23-107 [26932]
   Other proteins in same PDB: d1cr5a2, d1cr5b2, d1cr5c2
   complexed with nen

Details for d1cr5b1

PDB Entry: 1cr5, 2.3 Å

PDB Description: n-terminal domain of sec18p

PDB Compounds: (B:) sec18p (residues 22 - 210)

SCOPe Domain Sequences for d1cr5b1:

Sequence; same for both SEQRES and ATOM records:

>d1cr5b1 b.52.2.3 (B:23-107) N-terminal domain of NSF-N, NSF-Nn {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]}
dtrtrhlkvsncpnnsyalanvaavspndfpnniyiiidnlfvfttrhsndippgtigfn
gnqrtwggwslnqdvqakafdlfky

Timeline for d1cr5b1:

• d1cr5b1 first appeared (with stable ids) in SCOP 1.55
  
• d1cr5b1 appears in SCOP 1.75
  
• d1cr5b1 appears in SCOPe 2.02
  
• d1cr5b1 appears in the current release, SCOPe 2.08