Lineage for d1cr5b1 (1cr5 B:23-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 804836Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 804878Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 805019Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)
  6. 805034Protein N-terminal domain of NSF-N, NSF-Nn [50709] (2 species)
    NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains
  7. 805035Species Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId:4932] [50711] (1 PDB entry)
  8. 805037Domain d1cr5b1: 1cr5 B:23-107 [26932]
    Other proteins in same PDB: d1cr5a2, d1cr5b2, d1cr5c2

Details for d1cr5b1

PDB Entry: 1cr5 (more details), 2.3 Å

PDB Description: n-terminal domain of sec18p
PDB Compounds: (B:) sec18p (residues 22 - 210)

SCOP Domain Sequences for d1cr5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cr5b1 b.52.2.3 (B:23-107) N-terminal domain of NSF-N, NSF-Nn {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]}
dtrtrhlkvsncpnnsyalanvaavspndfpnniyiiidnlfvfttrhsndippgtigfn
gnqrtwggwslnqdvqakafdlfky

SCOP Domain Coordinates for d1cr5b1:

Click to download the PDB-style file with coordinates for d1cr5b1.
(The format of our PDB-style files is described here.)

Timeline for d1cr5b1: