Class b: All beta proteins [48724] (178 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins) |
Protein N-terminal domain of NSF-N, NSF-Nn [50709] (2 species) NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains |
Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [50710] (2 PDB entries) |
Domain d1qdnc1: 1qdn C:1-85 [26930] Other proteins in same PDB: d1qdna2, d1qdnb2, d1qdnc2 complexed with bme, so4 |
PDB Entry: 1qdn (more details), 2.3 Å
SCOPe Domain Sequences for d1qdnc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qdnc1 b.52.2.3 (C:1-85) N-terminal domain of NSF-N, NSF-Nn {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} magrsmqaarcptdelslsncavvsekdyqsgqhvivrtspnhkyiftlrthpsvvpgsv afslpqrkwaglsigqeievalysf
Timeline for d1qdnc1:
View in 3D Domains from other chains: (mouse over for more information) d1qdna1, d1qdna2, d1qdnb1, d1qdnb2 |