Lineage for d1qdnc1 (1qdn C:1-85)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802794Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)
  6. 2802840Protein N-terminal domain of NSF-N, NSF-Nn [50709] (2 species)
    NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains
  7. 2802845Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [50710] (2 PDB entries)
  8. 2802849Domain d1qdnc1: 1qdn C:1-85 [26930]
    Other proteins in same PDB: d1qdna2, d1qdnb2, d1qdnc2
    complexed with bme, so4

Details for d1qdnc1

PDB Entry: 1qdn (more details), 2.3 Å

PDB Description: amino terminal domain of the n-ethylmaleimide sensitive fusion protein (nsf)
PDB Compounds: (C:) protein (n-ethylmaleimide sensitive fusion protein (nsf))

SCOPe Domain Sequences for d1qdnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qdnc1 b.52.2.3 (C:1-85) N-terminal domain of NSF-N, NSF-Nn {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
magrsmqaarcptdelslsncavvsekdyqsgqhvivrtspnhkyiftlrthpsvvpgsv
afslpqrkwaglsigqeievalysf

SCOPe Domain Coordinates for d1qdnc1:

Click to download the PDB-style file with coordinates for d1qdnc1.
(The format of our PDB-style files is described here.)

Timeline for d1qdnc1: