SCOPe 2.04: Domain d1qcsa1: 1qcs A:0-85

Lineage for d1qcsa1 (1qcs A:0-85)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)

6. Protein N-terminal domain of NSF-N, NSF-Nn [50709] (2 species)
   NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains

7. Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [50710] (2 PDB entries)

8. Domain d1qcsa1: 1qcs A:0-85 [26927]
   Other proteins in same PDB: d1qcsa2
   complexed with so4

Details for d1qcsa1

PDB Entry: 1qcs, 1.9 Å

PDB Description: n-terminal domain of n-ethylmaleimide sensitive factor (nsf)

PDB Compounds: (A:) n-ethylmaleimide sensitive factor (nsf-n)

SCOPe Domain Sequences for d1qcsa1:

Sequence; same for both SEQRES and ATOM records:

>d1qcsa1 b.52.2.3 (A:0-85) N-terminal domain of NSF-N, NSF-Nn {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
nmagrsmqaarcptdelslsncavvsekdyqsgqhvivrtspnhkyiftlrthpsvvpgs
vafslpqrkwaglsigqeievalysf

Timeline for d1qcsa1:

• d1qcsa1 first appeared (with stable ids) in SCOP 1.55
  
• d1qcsa1 appears in SCOPe 2.03
  
• d1qcsa1 appears in SCOPe 2.05
  
• d1qcsa1 appears in the current release, SCOPe 2.08