Lineage for d1qcsa1 (1qcs A:0-85)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16143Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
  4. 16157Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 16199Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (2 proteins)
  6. 16200Protein N-terminal domain of NSF-N, NSF-Nn [50709] (2 species)
  7. 16205Species Hamster (Cricetulus griseus) [TaxId:10029] [50710] (2 PDB entries)
  8. 16206Domain d1qcsa1: 1qcs A:0-85 [26927]
    Other proteins in same PDB: d1qcsa2

Details for d1qcsa1

PDB Entry: 1qcs (more details), 1.9 Å

PDB Description: n-terminal domain of n-ethylmaleimide sensitive factor (nsf)

SCOP Domain Sequences for d1qcsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcsa1 b.52.2.3 (A:0-85) N-terminal domain of NSF-N, NSF-Nn {Hamster (Cricetulus griseus)}
nmagrsmqaarcptdelslsncavvsekdyqsgqhvivrtspnhkyiftlrthpsvvpgs
vafslpqrkwaglsigqeievalysf

SCOP Domain Coordinates for d1qcsa1:

Click to download the PDB-style file with coordinates for d1qcsa1.
(The format of our PDB-style files is described here.)

Timeline for d1qcsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qcsa2