Lineage for d2mlaa_ (2mla A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635336Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 2635463Protein automated matches [197331] (11 species)
    not a true protein
  7. 2635478Species Mesobuthus martensii [TaxId:34649] [255319] (5 PDB entries)
  8. 2635499Domain d2mlaa_: 2mla A: [269249]
    automated match to d1bkta_

Details for d2mlaa_

PDB Entry: 2mla (more details)

PDB Description: Solution structure of BmKTX-D19K
PDB Compounds: (A:) Potassium channel toxin alpha-KTx 3.6

SCOPe Domain Sequences for d2mlaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mlaa_ g.3.7.2 (A:) automated matches {Mesobuthus martensii [TaxId: 34649]}
vginvkckhsgqclkpckkagmrfgkcingkcdctpk

SCOPe Domain Coordinates for d2mlaa_:

Click to download the PDB-style file with coordinates for d2mlaa_.
(The format of our PDB-style files is described here.)

Timeline for d2mlaa_: