| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
| Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins) structural evidence for the gene duplication within the barrel fold automatically mapped to Pfam PF00977 |
| Protein automated matches [190186] (10 species) not a true protein |
| Species Streptomyces sp. [TaxId:465541] [259607] (2 PDB entries) |
| Domain d4x9sa_: 4x9s A: [269163] automated match to d4tx9a_ complexed with so4 |
PDB Entry: 4x9s (more details), 1.6 Å
SCOPe Domain Sequences for d4x9sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x9sa_ c.1.2.1 (A:) automated matches {Streptomyces sp. [TaxId: 465541]}
vnklellpavdvrdgqavrlvhgvsgsetsygspleaalawqasgaewlhlvdldaafgt
gdnralvaeitgamdikvelsggirddaslaaalatgctrvnlgtaaletpewaakaiae
hgdriavgldvrgttlkgrgwtseggdlyetlarldsegcaryvvtdigkdgtltgpnle
llknvcaatdrpvvasggissledlralaalvpqgvegaivgkalyakaftleealkvvs
a
Timeline for d4x9sa_: