Lineage for d4x9sa_ (4x9s A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815757Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1815758Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 1815791Protein automated matches [190186] (9 species)
    not a true protein
  7. 1815812Species Streptomyces sp. [TaxId:465541] [259607] (2 PDB entries)
  8. 1815814Domain d4x9sa_: 4x9s A: [269163]
    automated match to d4tx9a_
    complexed with so4

Details for d4x9sa_

PDB Entry: 4x9s (more details), 1.6 Å

PDB Description: crystal structure of hisap from streptomyces sp. mg1
PDB Compounds: (A:) phosphoribosyl isomerase a

SCOPe Domain Sequences for d4x9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x9sa_ c.1.2.1 (A:) automated matches {Streptomyces sp. [TaxId: 465541]}
vnklellpavdvrdgqavrlvhgvsgsetsygspleaalawqasgaewlhlvdldaafgt
gdnralvaeitgamdikvelsggirddaslaaalatgctrvnlgtaaletpewaakaiae
hgdriavgldvrgttlkgrgwtseggdlyetlarldsegcaryvvtdigkdgtltgpnle
llknvcaatdrpvvasggissledlralaalvpqgvegaivgkalyakaftleealkvvs
a

SCOPe Domain Coordinates for d4x9sa_:

Click to download the PDB-style file with coordinates for d4x9sa_.
(The format of our PDB-style files is described here.)

Timeline for d4x9sa_: