SCOPe 2.07: Domain d1bw3a_: 1bw3 A:

Lineage for d1bw3a_ (1bw3 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families)

5. Family b.52.1.2: Barwin [50689] (2 proteins)
   automatically mapped to Pfam PF00967

6. Protein Barwin [50690] (1 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [50691] (2 PDB entries)

8. Domain d1bw3a_: 1bw3 A: [26899]

Details for d1bw3a_

PDB Entry: 1bw3

PDB Description: three-dimensional structure in solution of barwin, a protein from barley seed

PDB Compounds: (A:) barwin, basic barley seed protein

SCOPe Domain Sequences for d1bw3a_:

Sequence; same for both SEQRES and ATOM records:

>d1bw3a_ b.52.1.2 (A:) Barwin {Barley (Hordeum vulgare) [TaxId: 4513]}
eqandvratyhyyrpaqnnwdlgapavsaycatwdaskplswrskygwtafcgpagprgq
aacgkclrvtnpatgaqitarivdqcanggldldwdtvftkidtngigyqqghlnvnyqf
vdcrd

Timeline for d1bw3a_:

• d1bw3a_ first appeared (with stable ids) in SCOP 1.55, called d1bw3__
  
• d1bw3a_ appears in SCOPe 2.06
  
• d1bw3a_ appears in the current release, SCOPe 2.08