Lineage for d1bw3a_ (1bw3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802577Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) (S)
  5. 2802600Family b.52.1.2: Barwin [50689] (2 proteins)
    automatically mapped to Pfam PF00967
  6. 2802601Protein Barwin [50690] (1 species)
  7. 2802602Species Barley (Hordeum vulgare) [TaxId:4513] [50691] (2 PDB entries)
  8. 2802603Domain d1bw3a_: 1bw3 A: [26899]

Details for d1bw3a_

PDB Entry: 1bw3 (more details)

PDB Description: three-dimensional structure in solution of barwin, a protein from barley seed
PDB Compounds: (A:) barwin, basic barley seed protein

SCOPe Domain Sequences for d1bw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw3a_ b.52.1.2 (A:) Barwin {Barley (Hordeum vulgare) [TaxId: 4513]}
eqandvratyhyyrpaqnnwdlgapavsaycatwdaskplswrskygwtafcgpagprgq
aacgkclrvtnpatgaqitarivdqcanggldldwdtvftkidtngigyqqghlnvnyqf
vdcrd

SCOPe Domain Coordinates for d1bw3a_:

Click to download the PDB-style file with coordinates for d1bw3a_.
(The format of our PDB-style files is described here.)

Timeline for d1bw3a_: