Lineage for d4tvob2 (4tvo B:158-330)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2605462Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2605463Protein automated matches [226850] (47 species)
    not a true protein
  7. 2605647Species Mycobacterium tuberculosis [TaxId:83332] [268877] (2 PDB entries)
  8. 2605649Domain d4tvob2: 4tvo B:158-330 [268880]
    Other proteins in same PDB: d4tvoa1, d4tvoa3, d4tvob1
    automated match to d1bdma2
    complexed with na, so4

Details for d4tvob2

PDB Entry: 4tvo (more details), 1.5 Å

PDB Description: Structure of Malate Dehydrogenase from Mycobacterium tuberculosis
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d4tvob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tvob2 d.162.1.0 (B:158-330) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
trldhnraisqlaaktgaavtdikkmtiwgnhsatqypdlfhaevagknaaevvndqawi
edefiptvakrgaaiidargassaasaasatidaardwllgtpaddwvsmavvsdgsygv
peglissfpvttkggnwtivsgleidefsrgridkstaeladersavtelgli

SCOPe Domain Coordinates for d4tvob2:

Click to download the PDB-style file with coordinates for d4tvob2.
(The format of our PDB-style files is described here.)

Timeline for d4tvob2: