Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (47 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [268877] (2 PDB entries) |
Domain d4tvob2: 4tvo B:158-330 [268880] Other proteins in same PDB: d4tvoa1, d4tvoa3, d4tvob1 automated match to d1bdma2 complexed with na, so4 |
PDB Entry: 4tvo (more details), 1.5 Å
SCOPe Domain Sequences for d4tvob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tvob2 d.162.1.0 (B:158-330) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} trldhnraisqlaaktgaavtdikkmtiwgnhsatqypdlfhaevagknaaevvndqawi edefiptvakrgaaiidargassaasaasatidaardwllgtpaddwvsmavvsdgsygv peglissfpvttkggnwtivsgleidefsrgridkstaeladersavtelgli
Timeline for d4tvob2: