Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [186789] (19 PDB entries) |
Domain d4tvoa1: 4tvo A:4-157 [268876] Other proteins in same PDB: d4tvoa2, d4tvoa3, d4tvob2 automated match to d1bdma1 complexed with na, so4 |
PDB Entry: 4tvo (more details), 1.5 Å
SCOPe Domain Sequences for d4tvoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tvoa1 c.2.1.0 (A:4-157) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} asplkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegvvmelddca fpllsgveigsdpqkifdgvslallvgarprgagmersdlleangaiftaqgkalnavaa ddvrvgvtgnpantnaliamtnapdiprerfsal
Timeline for d4tvoa1: