Lineage for d4qy2e_ (4qy2 E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047955Protein automated matches [190291] (25 species)
    not a true protein
  7. 2048055Species Influenza A virus [TaxId:11320] [187142] (23 PDB entries)
  8. 2048073Domain d4qy2e_: 4qy2 E: [268671]
    Other proteins in same PDB: d4qy2b_, d4qy2d_, d4qy2f_, d4qy2h_, d4qy2j_, d4qy2l_
    automated match to d4cyza_
    complexed with nag, sia

Details for d4qy2e_

PDB Entry: 4qy2 (more details), 2.4 Å

PDB Description: structure of h10 from human-infecting h10n8 virus in complex with human receptor analog
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4qy2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qy2e_ b.19.1.2 (E:) automated matches {Influenza A virus [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekndlygtqsisisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnrrslmlatgmrnvpe

SCOPe Domain Coordinates for d4qy2e_:

Click to download the PDB-style file with coordinates for d4qy2e_.
(The format of our PDB-style files is described here.)

Timeline for d4qy2e_: