Lineage for d4qy2d_ (4qy2 D:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267482Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries)
  8. 2267492Domain d4qy2d_: 4qy2 D: [268676]
    Other proteins in same PDB: d4qy2a_, d4qy2c_, d4qy2e_, d4qy2g_, d4qy2i_, d4qy2k_
    automated match to d4d00d_
    complexed with nag, sia

Details for d4qy2d_

PDB Entry: 4qy2 (more details), 2.4 Å

PDB Description: structure of h10 from human-infecting h10n8 virus in complex with human receptor analog
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4qy2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qy2d_ h.3.1.1 (D:) automated matches {Influenza A virus [TaxId: 11320]}
glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin

SCOPe Domain Coordinates for d4qy2d_:

Click to download the PDB-style file with coordinates for d4qy2d_.
(The format of our PDB-style files is described here.)

Timeline for d4qy2d_: