Lineage for d4pvfb_ (4pvf B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131911Protein Serine hydroxymethyltransferase [53429] (6 species)
  7. 2131965Species Human (Homo sapiens), mitochondrial [TaxId:9606] [142671] (4 PDB entries)
    Uniprot P34897 42-504
  8. 2131969Domain d4pvfb_: 4pvf B: [268596]
    automated match to d3ou5a_
    complexed with gol, peg

Details for d4pvfb_

PDB Entry: 4pvf (more details), 2.6 Å

PDB Description: crystal structure of homo sapiens holo serine hydroxymethyltransferase 2 (mitochondrial) (shmt2), isoform 3, transcript variant 5, 483 aa, at 2.6 ang. resolution
PDB Compounds: (B:) Serine hydroxymethyltransferase, mitochondrial

SCOPe Domain Sequences for d4pvfb_:

Sequence, based on SEQRES records: (download)

>d4pvfb_ c.67.1.4 (B:) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
wtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypg
kryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrim
gldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltarlfrprlii
agtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadivtttthktl
rgarsglifyrkgvkavdpktgreipytfedrinfavfpslqggphnhaiaavavalkqa
ctpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlel
vsitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevkskt
aklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh

Sequence, based on observed residues (ATOM records): (download)

>d4pvfb_ c.67.1.4 (B:) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
wtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypg
kryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrim
gldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltarlfrprlii
agtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadivtttthktl
rgarsglifyrkgvkaipytfedrinfavfpslqggphnhaiaavavalkqactpmfrey
slqvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlelvsitankn
tctpgglrlgapaltsrqfreddfrrvvdfidegvniglevksktaklqdfksfllkdse
tsqrlanlrqrveqfarafpmpgfdeh

SCOPe Domain Coordinates for d4pvfb_:

Click to download the PDB-style file with coordinates for d4pvfb_.
(The format of our PDB-style files is described here.)

Timeline for d4pvfb_: