Lineage for d4o7ud_ (4o7u D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923787Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1923788Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1923789Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1924078Protein automated matches [190469] (12 species)
    not a true protein
  7. 1924101Species Enterococcus faecalis [TaxId:1351] [194752] (2 PDB entries)
  8. 1924109Domain d4o7ud_: 4o7u D: [268470]
    automated match to d3uwlb_
    complexed with edo, so4, ss7, thf

Details for d4o7ud_

PDB Entry: 4o7u (more details), 2.4 Å

PDB Description: etherocomplex of enteroccocus faecalis thymidylate synthase with 5- hydroxymethilene-6-hydrofolic acid and the phtalimidic inhibitor ss7
PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d4o7ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o7ud_ d.117.1.1 (D:) automated matches {Enterococcus faecalis [TaxId: 1351]}
meeaylalgkkileeghfkedrtgtgtyslfgyqmrfdlakgfpllttkrvpfgliksel
lwflkgdtniryllernnhiwdewaferyvksadyqgpdmtdfghrvlqdpafaeqykee
hqkfcdailndaefaekygelgniygaqwrhwetkdgsfidqlanviemiktnpdsrrli
vsawnpedvpsmalppchtmfqfyvnegklscqlyqrsadvflgvpfniasyallthlia
hetglevgefvhtlgdahlyqnhveqmqeqlsrevrsfptlvlnpdkasvfdfdmedikv
egydphptikapiav

SCOPe Domain Coordinates for d4o7ud_:

Click to download the PDB-style file with coordinates for d4o7ud_.
(The format of our PDB-style files is described here.)

Timeline for d4o7ud_: