Lineage for d4pepa_ (4pep A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2802095Protein Pepsin(ogen) [50658] (4 species)
  7. 2802108Species Pig (Sus scrofa) [TaxId:9823] [50659] (12 PDB entries)
  8. 2802115Domain d4pepa_: 4pep A: [26843]

Details for d4pepa_

PDB Entry: 4pep (more details), 1.8 Å

PDB Description: the molecular and crystal structures of monoclinic porcine pepsin refined at 1.8 angstroms resolution
PDB Compounds: (A:) pepsin

SCOPe Domain Sequences for d4pepa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pepa_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
sdgemviscssidslpdivftidgvqyplspsayilqdddsctsgfegmdvptssgelwi
lgdvfirqyytvfdrannkvglapva

SCOPe Domain Coordinates for d4pepa_:

Click to download the PDB-style file with coordinates for d4pepa_.
(The format of our PDB-style files is described here.)

Timeline for d4pepa_: