Lineage for d4o00b1 (4o00 B:4-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762289Domain d4o00b1: 4o00 B:4-106 [268419]
    Other proteins in same PDB: d4o00a2, d4o00b2
    automated match to d1bpva_

Details for d4o00b1

PDB Entry: 4o00 (more details), 1.85 Å

PDB Description: crystal structure of the titin a-band domain a3
PDB Compounds: (B:) titin

SCOPe Domain Sequences for d4o00b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o00b1 b.1.2.0 (B:4-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erpsppvnltssdqtqssvqlkwepplkdggspilgyiierceegkdnwircnmklvpel
tykvtglekgnkylyrvsaenkagvsdpseilgpltaddafve

SCOPe Domain Coordinates for d4o00b1:

Click to download the PDB-style file with coordinates for d4o00b1.
(The format of our PDB-style files is described here.)

Timeline for d4o00b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4o00b2