![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
![]() | Protein automated matches [190976] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries) |
![]() | Domain d4o00a1: 4o00 A:4-104 [268421] Other proteins in same PDB: d4o00a2, d4o00b2 automated match to d1bpva_ |
PDB Entry: 4o00 (more details), 1.85 Å
SCOPe Domain Sequences for d4o00a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o00a1 b.1.2.0 (A:4-104) automated matches {Human (Homo sapiens) [TaxId: 9606]} erpsppvnltssdqtqssvqlkwepplkdggspilgyiierceegkdnwircnmklvpel tykvtglekgnkylyrvsaenkagvsdpseilgpltaddaf
Timeline for d4o00a1: