Lineage for d1fq4a_ (1fq4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2800799Protein Acid protease [50649] (9 species)
  7. 2800800Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (12 PDB entries)
    synonym: saccharopepsin
  8. 2800810Domain d1fq4a_: 1fq4 A: [26832]
    complexed with 2y2, nag

Details for d1fq4a_

PDB Entry: 1fq4 (more details), 2.7 Å

PDB Description: crystal structure of a complex between hydroxyethylene inhibitor cp- 108,420 and yeast aspartic proteinase a
PDB Compounds: (A:) saccharopepsin

SCOPe Domain Sequences for d1fq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq4a_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
laivgdaflrkyysiydignnavglakai

SCOPe Domain Coordinates for d1fq4a_:

Click to download the PDB-style file with coordinates for d1fq4a_.
(The format of our PDB-style files is described here.)

Timeline for d1fq4a_: