Lineage for d1fq4a_ (1fq4 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) Protein Acid protease [50649] (5 species) 
Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (8 PDB entries) 
Domain d1fq4a_: 1fq4 A: [26832]
Details for d1fq4a_
PDB Entry: 1fq4 (more details), 2.7 Å
PDB Description: crystal structure of a complex between hydroxyethylene inhibitor cp- 108,420 and yeast aspartic proteinase a
SCOP Domain Sequences for d1fq4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fq4a_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
laivgdaflrkyysiydignnavglakai
SCOP Domain Coordinates for d1fq4a_:
Click to download the PDB-style file with coordinates for d1fq4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fq4a_:
- d1fq4a_ appears in SCOP 1.57
- d1fq4a_ appears in the current release, SCOPe 2.08
View in 3D