Lineage for d3wpta_ (3wpt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006450Protein automated matches [190070] (4 species)
    not a true protein
  7. 2006457Species Human (Homo sapiens) [TaxId:9606] [187211] (12 PDB entries)
  8. 2006465Domain d3wpta_: 3wpt A: [268048]
    automated match to d3knda_
    complexed with peg

Details for d3wpta_

PDB Entry: 3wpt (more details), 2.63 Å

PDB Description: Crystal structure of closed dimer of human importin-alpha1 (Rch1)
PDB Compounds: (A:) Importin subunit alpha-1

SCOPe Domain Sequences for d3wpta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wpta_ a.118.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nwsvddivkginssnvenqlqatqaarkllsrekqppidniiraglipkfvsflgrtdcs
piqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgs
vfrdlvikygavdpllallavpdmsslacgylrnltwtlsnlcrnknpappidaveqilp
tlvrllhhddpevladtcwaisyltdgpnerigmvvktgvvpqlvkllgaselpivtpal
raignivtgtdeqtqvvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvv
nhglvpflvsvlskadfktqkeavwavtnytsggtveqivylvhcgiieplmnlltakdt
kiilvildaisnifqaaeklgeteklsimieecggldkiealqnhenesvykaslsliek
yf

SCOPe Domain Coordinates for d3wpta_:

Click to download the PDB-style file with coordinates for d3wpta_.
(The format of our PDB-style files is described here.)

Timeline for d3wpta_: