SCOPe 2.08: Domain d1sipa_: 1sip A:

Lineage for d1sipa_ (1sip A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (7 PDB entries)

8. Domain d1sipa_: 1sip A: [26757]

Details for d1sipa_

PDB Entry: 1sip, 2.3 Å

PDB Description: alternative native flap conformation revealed by 2.3 angstroms resolution structure of siv proteinase

PDB Compounds: (A:) unliganded siv protease

SCOPe Domain Sequences for d1sipa_:

Sequence; same for both SEQRES and ATOM records:

>d1sipa_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nveievlgkrirgtimtgdtpinifgrnlltalgmslnf

Timeline for d1sipa_:

• d1sipa_ first appeared (with stable ids) in SCOP 1.55, called d1sip__
  
• d1sipa_ appears in SCOPe 2.07