![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species) |
![]() | Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (7 PDB entries) |
![]() | Domain d1sipa_: 1sip A: [26757] |
PDB Entry: 1sip (more details), 2.3 Å
SCOPe Domain Sequences for d1sipa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sipa_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]} pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk nveievlgkrirgtimtgdtpinifgrnlltalgmslnf
Timeline for d1sipa_: