Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins) |
Protein automated matches [190110] (7 species) not a true protein |
Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries) |
Domain d4uqpb_: 4uqp B: [267476] Other proteins in same PDB: d4uqpq_, d4uqpr_ automated match to d1ubks_ complexed with f3s, fco, gly, gol, h2s, mg, ni, sf4, sot; mutant |
PDB Entry: 4uqp (more details), 1.42 Å
SCOPe Domain Sequences for d4uqpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uqpb_ e.19.1.1 (B:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]} takhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalh qalegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvq kakpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfyge lvhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqa ghpclgcsepdfwdtmtpfyeqg
Timeline for d4uqpb_: