SCOPe 2.06: Domain d4uqpb_: 4uqp B:

Lineage for d4uqpb_ (4uqp B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein automated matches [190110] (7 species)
   not a true protein

7. Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries)

8. Domain d4uqpb_: 4uqp B: [267476]
   Other proteins in same PDB: d4uqpq_, d4uqpr_
   automated match to d1ubks_
   complexed with f3s, fco, gly, gol, h2s, mg, ni, sf4, sot; mutant

Details for d4uqpb_

PDB Entry: 4uqp, 1.42 Å

PDB Description: high-resolution structure of the d. fructosovorans nife-hydrogenase l122a mutant after exposure to air

PDB Compounds: (B:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d4uqpb_:

Sequence; same for both SEQRES and ATOM records:

>d4uqpb_ e.19.1.1 (B:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
takhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalh
qalegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvq
kakpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfyge
lvhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqa
ghpclgcsepdfwdtmtpfyeqg

Timeline for d4uqpb_:

• d4uqpb_ first appeared in SCOPe 2.05
  
• d4uqpb_ appears in SCOPe 2.07
  
• d4uqpb_ appears in the current release, SCOPe 2.08