SCOPe 2.07: Domain d4pyqa_: 4pyq A:

Lineage for d4pyqa_ (4pyq A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.1: COMT-like [53336] (4 proteins)

6. Protein Catechol O-methyltransferase, COMT [53337] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (87 PDB entries)

8. Domain d4pyqa_: 4pyq A: [267248]
   automated match to d4p7ka_
   protein/RNA complex; complexed with 2x1, act, cl, na, so4

Details for d4pyqa_

PDB Entry: 4pyq, 1.39 Å

PDB Description: Humanized rat apo-COMT in complex with a ureido-benzamidine

PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d4pyqa_:

Sequence; same for both SEQRES and ATOM records:

>d4pyqa_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp

Timeline for d4pyqa_:

• d4pyqa_ first appeared in SCOPe 2.05
  
• d4pyqa_ appears in SCOPe 2.06
  
• d4pyqa_ appears in the current release, SCOPe 2.08