Lineage for d4pyqa_ (4pyq A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2500489Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2500500Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. 2500516Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (87 PDB entries)
  8. 2500534Domain d4pyqa_: 4pyq A: [267248]
    automated match to d4p7ka_
    protein/RNA complex; complexed with 2x1, act, cl, na, so4

Details for d4pyqa_

PDB Entry: 4pyq (more details), 1.39 Å

PDB Description: Humanized rat apo-COMT in complex with a ureido-benzamidine
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d4pyqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pyqa_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d4pyqa_:

Click to download the PDB-style file with coordinates for d4pyqa_.
(The format of our PDB-style files is described here.)

Timeline for d4pyqa_: