SCOPe 2.07: Domain d4orgf2: 4org F:108-210

Lineage for d4orgf2 (4org F:108-210)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4orgf2: 4org F:108-210 [267091]
   Other proteins in same PDB: d4orgb1, d4orgd1, d4orgf1, d4orgl1
   automated match to d3zl4l2

Details for d4orgf2

PDB Entry: 4org, 3.12 Å

PDB Description: Crystal structure of human Fab CAP256-VRC26.04, a potent V1V2-directed HIV-1 neutralizing antibody

PDB Compounds: (F:) CAP256-VRC26.04 light chain

SCOPe Domain Sequences for d4orgf2:

Sequence; same for both SEQRES and ATOM records:

>d4orgf2 b.1.1.2 (F:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d4orgf2:

• d4orgf2 first appeared in SCOPe 2.05
  
• d4orgf2 appears in SCOPe 2.06
  
• d4orgf2 appears in the current release, SCOPe 2.08