Lineage for d4orgf2 (4org F:108-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752297Domain d4orgf2: 4org F:108-210 [267091]
    Other proteins in same PDB: d4orga_, d4orgb1, d4orgc_, d4orgd1, d4orge_, d4orgf1, d4orgh_, d4orgl1
    automated match to d3zl4l2

Details for d4orgf2

PDB Entry: 4org (more details), 3.12 Å

PDB Description: Crystal structure of human Fab CAP256-VRC26.04, a potent V1V2-directed HIV-1 neutralizing antibody
PDB Compounds: (F:) CAP256-VRC26.04 light chain

SCOPe Domain Sequences for d4orgf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4orgf2 b.1.1.2 (F:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d4orgf2:

Click to download the PDB-style file with coordinates for d4orgf2.
(The format of our PDB-style files is described here.)

Timeline for d4orgf2: