Lineage for d4mmya2 (4mmy A:439-598)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374900Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2374929Family b.1.15.0: automated matches [233856] (1 protein)
    not a true family
  6. 2374930Protein automated matches [233857] (1 species)
    not a true protein
  7. 2374931Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries)
  8. 2374959Domain d4mmya2: 4mmy A:439-598 [266744]
    Other proteins in same PDB: d4mmya1, d4mmyc_
    automated match to d1m1xa1
    complexed with bma, man, mn, nag

Details for d4mmya2

PDB Entry: 4mmy (more details), 3.18 Å

PDB Description: integrin alphavbeta3 ectodomain bound to the tenth domain of fibronectin with the iakgdwnd motif
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d4mmya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mmya2 b.1.15.0 (A:439-598) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif
meyrldyrtaadttglqpilnqftpanisrqahilldcge

SCOPe Domain Coordinates for d4mmya2:

Click to download the PDB-style file with coordinates for d4mmya2.
(The format of our PDB-style files is described here.)

Timeline for d4mmya2: