SCOPe 2.08: Domain d4mmmg1: 4mmm G:1-161

Lineage for d4mmmg1 (4mmm G:1-161)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d4mmmg1: 4mmm G:1-161 [266742]
   Other proteins in same PDB: d4mmma2, d4mmmc2, d4mmme2, d4mmmg2
   automated match to d3umac_
   complexed with bp7

Details for d4mmmg1

PDB Entry: 4mmm, 1.47 Å

PDB Description: Human Pdrx5 complex with a ligand BP7

PDB Compounds: (G:) Peroxiredoxin-5, mitochondrial

SCOPe Domain Sequences for d4mmmg1:

Sequence; same for both SEQRES and ATOM records:

>d4mmmg1 c.47.1.0 (G:1-161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae
alkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif
gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

Timeline for d4mmmg1:

• d4mmmg1 first appeared in SCOPe 2.05, called d4mmmg_
  
• d4mmmg1 appears in SCOPe 2.07