SCOPe 2.07: Domain d1bv7a_: 1bv7 A:

Lineage for d1bv7a_ (1bv7 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (578 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d1bv7a_: 1bv7 A: [26629]
   complexed with xv6; mutant

Details for d1bv7a_

PDB Entry: 1bv7, 2 Å

PDB Description: counteracting hiv-1 protease drug resistance: structural analysis of mutant proteases complexed with xv638 and sd146, cyclic urea amides with broad specificities

PDB Compounds: (A:) protein (hiv-1 protease)

SCOPe Domain Sequences for d1bv7a_:

Sequence; same for both SEQRES and ATOM records:

>d1bv7a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfniigrnlltqigctlnf

Timeline for d1bv7a_:

• d1bv7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1bv7a_ appears in SCOPe 2.06
  
• d1bv7a_ appears in the current release, SCOPe 2.08