SCOPe 2.07: Domain d4fi4c1: 4fi4 C:1-112

Lineage for d4fi4c1 (4fi4 C:1-112)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Caulobacter sp. [TaxId:366602] [267933] (1 PDB entry)

8. Domain d4fi4c1: 4fi4 C:1-112 [266253]
   Other proteins in same PDB: d4fi4a2, d4fi4a3, d4fi4b2, d4fi4c2
   automated match to d4il2a1
   complexed with cl, gol, mg, unl

Details for d4fi4c1

PDB Entry: 4fi4, 2 Å

PDB Description: crystal structure of mannonate dehydratase prk15072 (target efi-502214) from caulobacter sp. k31

PDB Compounds: (C:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d4fi4c1:

Sequence; same for both SEQRES and ATOM records:

>d4fi4c1 d.54.1.0 (C:1-112) automated matches {Caulobacter sp. [TaxId: 366602]}
mlkiidakvivtcpgrnfvtlkittsdgvtgvgdatlngrelavvsylrdhmipcligrd
ahriedvwqffyrgsywrggpvamtalaavdmalwdikaklagmplyqllgg

Timeline for d4fi4c1:

• d4fi4c1 first appeared in SCOPe 2.05
  
• d4fi4c1 appears in SCOPe 2.06
  
• d4fi4c1 appears in the current release, SCOPe 2.08