Lineage for d4fi4c1 (4fi4 C:1-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948043Species Caulobacter sp. [TaxId:366602] [267933] (1 PDB entry)
  8. 2948046Domain d4fi4c1: 4fi4 C:1-112 [266253]
    Other proteins in same PDB: d4fi4a2, d4fi4a3, d4fi4b2, d4fi4c2
    automated match to d4il2a1
    complexed with cl, gol, mg, unl

Details for d4fi4c1

PDB Entry: 4fi4 (more details), 2 Å

PDB Description: crystal structure of mannonate dehydratase prk15072 (target efi-502214) from caulobacter sp. k31
PDB Compounds: (C:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d4fi4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fi4c1 d.54.1.0 (C:1-112) automated matches {Caulobacter sp. [TaxId: 366602]}
mlkiidakvivtcpgrnfvtlkittsdgvtgvgdatlngrelavvsylrdhmipcligrd
ahriedvwqffyrgsywrggpvamtalaavdmalwdikaklagmplyqllgg

SCOPe Domain Coordinates for d4fi4c1:

Click to download the PDB-style file with coordinates for d4fi4c1.
(The format of our PDB-style files is described here.)

Timeline for d4fi4c1: