Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.8: Aerolisin/ETX pore-forming domain [56972] (1 superfamily) 3 domains: (1) alpha+beta; (2&3) all-beta |
Superfamily f.8.1: Aerolisin/ETX pore-forming domain [56973] (3 families) |
Family f.8.1.3: Clostridium perfringens enterotoxin (CPE), pore-forming domain [267612] (2 proteins) N-terminal part of Pfam PF03505, PubMed 21489981 |
Protein automated matches [267674] (1 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [267811] (3 PDB entries) |
Domain d3ziwc1: 3ziw C:38-199 [265793] Other proteins in same PDB: d3ziwa2, d3ziwa3, d3ziwb2, d3ziwb3, d3ziwc2, d3ziwc3, d3ziwd2, d3ziwd3, d3ziwe2, d3ziwe3, d3ziwf2, d3ziwf3 automated match to d3am2a2 complexed with p6g; mutant |
PDB Entry: 3ziw (more details), 1.9 Å
SCOPe Domain Sequences for d3ziwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ziwc1 f.8.1.3 (C:38-199) automated matches {Clostridium perfringens [TaxId: 1502]} sdglyvidkgagwilgepsvvssqilnpnetgtfsqsltkskevsinvnfsvgftsefiq asveygfgitigeqntiersvsttagpneyvyykvyatyrkyqairishgnisddgsiyk ltgiwlsktsadslgnidqgslietgercvltvpstdiekei
Timeline for d3ziwc1: