SCOPe 2.08: Domain d3wglb2: 3wgl B:207-314

Lineage for d3wglb2 (3wgl B:207-314)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.0: automated matches [227141] (1 protein)
   not a true family

6. Protein automated matches [226843] (9 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [267906] (1 PDB entry)

8. Domain d3wglb2: 3wgl B:207-314 [265646]
   Other proteins in same PDB: d3wgla1, d3wglb1
   automated match to d4m8ia2
   complexed with gdp; mutant

Details for d3wglb2

PDB Entry: 3wgl, 3.07 Å

PDB Description: staphylococcus aureus ftsz t7 mutant substituted for gan bound with gdp, deltat7gan-gdp

PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d3wglb2:

Sequence; same for both SEQRES and ATOM records:

>d3wglb2 d.79.2.0 (B:207-314) automated matches {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgfd

Timeline for d3wglb2:

• d3wglb2 first appeared in SCOPe 2.05
  
• d3wglb2 appears in SCOPe 2.07