| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.0: automated matches [227141] (1 protein) not a true family |
| Protein automated matches [226843] (9 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158878] [267906] (1 PDB entry) |
| Domain d3wglb2: 3wgl B:207-314 [265646] Other proteins in same PDB: d3wgla1, d3wglb1 automated match to d4m8ia2 complexed with gdp; mutant |
PDB Entry: 3wgl (more details), 3.07 Å
SCOPe Domain Sequences for d3wglb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wglb2 d.79.2.0 (B:207-314) automated matches {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgfd
Timeline for d3wglb2: