Lineage for d3wgla2 (3wgl A:207-313)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2960042Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2960043Protein automated matches [226843] (9 species)
    not a true protein
  7. 2960083Species Staphylococcus aureus [TaxId:158878] [267906] (1 PDB entry)
  8. 2960084Domain d3wgla2: 3wgl A:207-313 [265644]
    Other proteins in same PDB: d3wgla1, d3wglb1
    automated match to d4m8ia2
    complexed with gdp; mutant

Details for d3wgla2

PDB Entry: 3wgl (more details), 3.07 Å

PDB Description: staphylococcus aureus ftsz t7 mutant substituted for gan bound with gdp, deltat7gan-gdp
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d3wgla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgla2 d.79.2.0 (A:207-313) automated matches {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d3wgla2:

Click to download the PDB-style file with coordinates for d3wgla2.
(The format of our PDB-style files is described here.)

Timeline for d3wgla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wgla1