Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (30 species) not a true protein |
Species Gluconobacter oxydans [TaxId:290633] [256462] (2 PDB entries) |
Domain d3wbxb_: 3wbx B: [265592] automated match to d3f7ja_ complexed with so4 |
PDB Entry: 3wbx (more details), 2.4 Å
SCOPe Domain Sequences for d3wbxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wbxb_ c.1.7.0 (B:) automated matches {Gluconobacter oxydans [TaxId: 290633]} eaqtvisfhdghtmpqiglgvwetppdetaevvkeavklgyrsvdtarlykneegvgkgl edhpeiflttklwndeqgydstlrayeesarllrrpvldlylihwpmpaqgqyvetwkal velkksgrvksigvsnfesehlerimdatgvvpvvnqielhpdfqqralrefhekhnirt eswrplgkgrvlsderigkiaekhsrtpaqvvirwhlqnglivipksvnpkrlaenldvf gfvldaddmqaieqmdrkdgrmgadpntakf
Timeline for d3wbxb_: