Lineage for d3wbxb_ (3wbx B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2438355Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2438356Protein automated matches [190793] (30 species)
    not a true protein
  7. 2438428Species Gluconobacter oxydans [TaxId:290633] [256462] (2 PDB entries)
  8. 2438432Domain d3wbxb_: 3wbx B: [265592]
    automated match to d3f7ja_
    complexed with so4

Details for d3wbxb_

PDB Entry: 3wbx (more details), 2.4 Å

PDB Description: Crystal structure of Gox0644 at apoform
PDB Compounds: (B:) Putative 2,5-diketo-D-gluconic acid reductase

SCOPe Domain Sequences for d3wbxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wbxb_ c.1.7.0 (B:) automated matches {Gluconobacter oxydans [TaxId: 290633]}
eaqtvisfhdghtmpqiglgvwetppdetaevvkeavklgyrsvdtarlykneegvgkgl
edhpeiflttklwndeqgydstlrayeesarllrrpvldlylihwpmpaqgqyvetwkal
velkksgrvksigvsnfesehlerimdatgvvpvvnqielhpdfqqralrefhekhnirt
eswrplgkgrvlsderigkiaekhsrtpaqvvirwhlqnglivipksvnpkrlaenldvf
gfvldaddmqaieqmdrkdgrmgadpntakf

SCOPe Domain Coordinates for d3wbxb_:

Click to download the PDB-style file with coordinates for d3wbxb_.
(The format of our PDB-style files is described here.)

Timeline for d3wbxb_: