Lineage for d3f7ja_ (3f7j A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sitesSuperfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) 
Family c.1.7.0: automated matches [191491] (1 protein)
not a true familyProtein automated matches [190793] (30 species)
not a true protein
Species Bacillus subtilis [TaxId:1423] [196103] (4 PDB entries) 
Domain d3f7ja_: 3f7j A: [199392]
automated match to d3f7jb_
complexed with k, no3
Details for d3f7ja_
PDB Entry: 3f7j (more details), 1.7 Å
PDB Description: B.subtilis YvgN
PDB Compounds: (A:) YvgN proteinSCOPe Domain Sequences for d3f7ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f7ja_ c.1.7.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mptslkdtvklhngvempwfglgvfkvengneatesvkaaikngyrsidtaaiykneegv
gigikesgvareelfitskvwnedqgyettlaafekslerlqldyldlylihwpgkdkyk
dtwraleklykdgkiraigvsnfqvhhleellkdaeikpmvnqvefhprltqkelrdyck
gqgiqleawsplmqgqlldnevltqiaekhnksvaqvilrwdlqhgvvtipksikehrii
enadifdfelsqedmdkidalnkdervgpnpdellf
SCOPe Domain Coordinates for d3f7ja_:
Click to download the PDB-style file with coordinates for d3f7ja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3f7ja_:
- d3f7ja_ first appeared in SCOPe 2.03
- d3f7ja_ appears in SCOPe 2.06
- d3f7ja_ appears in the current release, SCOPe 2.08
View in 3D
