Lineage for d3f7ja_ (3f7j A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2415941Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2416428Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2416429Protein automated matches [190793] (26 species)
    not a true protein
  7. 2416435Species Bacillus subtilis [TaxId:1423] [196103] (4 PDB entries)
  8. 2416438Domain d3f7ja_: 3f7j A: [199392]
    automated match to d3f7jb_
    complexed with k, no3

Details for d3f7ja_

PDB Entry: 3f7j (more details), 1.7 Å

PDB Description: B.subtilis YvgN
PDB Compounds: (A:) YvgN protein

SCOPe Domain Sequences for d3f7ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f7ja_ c.1.7.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mptslkdtvklhngvempwfglgvfkvengneatesvkaaikngyrsidtaaiykneegv
gigikesgvareelfitskvwnedqgyettlaafekslerlqldyldlylihwpgkdkyk
dtwraleklykdgkiraigvsnfqvhhleellkdaeikpmvnqvefhprltqkelrdyck
gqgiqleawsplmqgqlldnevltqiaekhnksvaqvilrwdlqhgvvtipksikehrii
enadifdfelsqedmdkidalnkdervgpnpdellf

SCOPe Domain Coordinates for d3f7ja_:

Click to download the PDB-style file with coordinates for d3f7ja_.
(The format of our PDB-style files is described here.)

Timeline for d3f7ja_: