SCOPe 2.08: Domain d3tw9d1: 3tw9 D:5-118

Lineage for d3tw9d1 (3tw9 D:5-118)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Salmonella enterica [TaxId:550537] [267889] (3 PDB entries)

8. Domain d3tw9d1: 3tw9 D:5-118 [265407]
   Other proteins in same PDB: d3tw9a2, d3tw9b2, d3tw9c2, d3tw9d2
   automated match to d4ihca1
   complexed with cl, gol

Details for d3tw9d1

PDB Entry: 3tw9, 1.7 Å

PDB Description: crystal structure of gluconate dehydratase (target efi-501679) from salmonella enterica subsp. enterica serovar enteritidis str. p125109

PDB Compounds: (D:) Putative dehydratase

SCOPe Domain Sequences for d3tw9d1:

Sequence; same for both SEQRES and ATOM records:

>d3tw9d1 d.54.1.0 (D:5-118) automated matches {Salmonella enterica [TaxId: 550537]}
nlkitnvktiltapggidlavvkietnepglyglgcatftqrifavksaideymapflvg
kdptriediwqsgvvsgywrngpimnnalsgvdmalwdikgklagmpvydllgg

Timeline for d3tw9d1:

• d3tw9d1 first appeared in SCOPe 2.05
  
• d3tw9d1 appears in SCOPe 2.07