Lineage for d3tw9b2 (3tw9 B:119-419)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087095Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 protein domains)
  6. 2087289Protein automated matches [226997] (13 species)
    not a true protein
  7. 2087362Species Salmonella enterica [TaxId:550537] [267890] (3 PDB entries)
  8. 2087374Domain d3tw9b2: 3tw9 B:119-419 [265404]
    Other proteins in same PDB: d3tw9a1, d3tw9b1, d3tw9c1, d3tw9d1
    automated match to d4ihca2
    complexed with cl, gol

Details for d3tw9b2

PDB Entry: 3tw9 (more details), 1.7 Å

PDB Description: crystal structure of gluconate dehydratase (target efi-501679) from salmonella enterica subsp. enterica serovar enteritidis str. p125109
PDB Compounds: (B:) Putative dehydratase

SCOPe Domain Sequences for d3tw9b2:

Sequence, based on SEQRES records: (download)

>d3tw9b2 c.1.11.2 (B:119-419) automated matches {Salmonella enterica [TaxId: 550537]}
kcrdgiplychtdggdevevednirarmeegyqyvrcqmgmyggagtddlkliatqlara
kniqpkrsprsktpgiyfdpdayaksvprlfdhlrnklgfgiefihdvhervtpvtainl
aktleqyqlfyledpvapenidwlkmlrqqsstpismgelfvnvnewkplidnrlidyir
chvstiggitparklavyselngvrtawhgpgdispvgvcanmhldlsspnfgiqeytpm
ndalrdvfpgcpeidhgyaylndkpglgidideakaakypceggipswtmartpdgtasr
p

Sequence, based on observed residues (ATOM records): (download)

>d3tw9b2 c.1.11.2 (B:119-419) automated matches {Salmonella enterica [TaxId: 550537]}
kcrdgiplychtdggdevevednirarmeegyqyvrcqmgmygdlkliatqlarakniqp
krsprsktpgiyfdpdayaksvprlfdhlrnklgfgiefihdvhervtpvtainlaktle
qyqlfyledpvapenidwlkmlrqqsstpismgelfvnvnewkplidnrlidyirchvst
iggitparklavyselngvrtawhgpgdispvgvcanmhldlsspnfgiqeytpmndalr
dvfpgcpeidhgyaylndkpglgidideakaakypceggipswtmartpdgtasrp

SCOPe Domain Coordinates for d3tw9b2:

Click to download the PDB-style file with coordinates for d3tw9b2.
(The format of our PDB-style files is described here.)

Timeline for d3tw9b2: