SCOPe 2.07: Domain d3sudd_: 3sud D:

Lineage for d3sudd_ (3sud D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (22 PDB entries)

8. Domain d3sudd_: 3sud D: [265374]
   automated match to d3sv6a_
   complexed with so4, sue, zn

Details for d3sudd_

PDB Entry: 3sud, 1.96 Å

PDB Description: crystal structure of ns3/4a protease in complex with mk-5172

PDB Compounds: (D:) NS3 protease, NS4A protein

SCOPe Domain Sequences for d3sudd_:

Sequence; same for both SEQRES and ATOM records:

>d3sudd_ b.47.1.3 (D:) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]}
kgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsi
ngvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvt
rhadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavstrgvakavd
fipveslettm

Timeline for d3sudd_:

• d3sudd_ first appeared in SCOPe 2.05
  
• d3sudd_ appears in SCOPe 2.06
  
• d3sudd_ appears in the current release, SCOPe 2.08