Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (70 species) not a true protein |
Species Mycobacterium abscessus [TaxId:561007] [189671] (6 PDB entries) |
Domain d3r9qa_: 3r9q A: [265314] automated match to d4qfea_ complexed with cl, gol |
PDB Entry: 3r9q (more details), 2.1 Å
SCOPe Domain Sequences for d3r9qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r9qa_ c.14.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 561007]} qpavrvekagpvttvilnrpharnavdgptaaallaaftefdadpeasvavlwgdngtfc agadlkamgtdrgnelhphgpgpmgpsrlrlskpviaaisghavaggielalwcdlrvve edavlgvfcrrwgvplidggtirlprlighsramdliltgrpvhanealdiglvnrvvar gqareaaetlaaeiaafpqqcvradrdsaiaqwgmaeeaaldnefgsiervat
Timeline for d3r9qa_: