Lineage for d3r9qa_ (3r9q A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113311Species Mycobacterium abscessus [TaxId:561007] [189671] (6 PDB entries)
  8. 2113327Domain d3r9qa_: 3r9q A: [265314]
    automated match to d4qfea_
    complexed with cl, gol

Details for d3r9qa_

PDB Entry: 3r9q (more details), 2.1 Å

PDB Description: structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus atcc 19977 / dsm 44196
PDB Compounds: (A:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3r9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r9qa_ c.14.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
qpavrvekagpvttvilnrpharnavdgptaaallaaftefdadpeasvavlwgdngtfc
agadlkamgtdrgnelhphgpgpmgpsrlrlskpviaaisghavaggielalwcdlrvve
edavlgvfcrrwgvplidggtirlprlighsramdliltgrpvhanealdiglvnrvvar
gqareaaetlaaeiaafpqqcvradrdsaiaqwgmaeeaaldnefgsiervat

SCOPe Domain Coordinates for d3r9qa_:

Click to download the PDB-style file with coordinates for d3r9qa_.
(The format of our PDB-style files is described here.)

Timeline for d3r9qa_: