| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
| Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
| Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
| Species Thermus aquaticus [TaxId:271] [53121] (29 PDB entries) |
| Domain d3py8a1: 3py8 A:294-422 [265233] Other proteins in same PDB: d3py8a2 automated match to d1bgxt3 protein/DNA complex; complexed with dct, gol, mg, mn; mutant |
PDB Entry: 3py8 (more details), 1.74 Å
SCOPe Domain Sequences for d3py8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3py8a1 c.55.3.5 (A:294-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
leeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkearglla
kdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlf
anlwgrleg
Timeline for d3py8a1: