Lineage for d3lypa1 (3lyp A:8-85)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134916Species Pseudomonas fluorescens [TaxId:220664] [255947] (2 PDB entries)
  8. 2134917Domain d3lypa1: 3lyp A:8-85 [265044]
    Other proteins in same PDB: d3lypa2, d3lypb2
    automated match to d3mdkb1

Details for d3lypa1

PDB Entry: 3lyp (more details), 1.6 Å

PDB Description: structure of stringent starvation protein a homolog from pseudomonas fluorescens
PDB Compounds: (A:) stringent starvation protein A

SCOPe Domain Sequences for d3lypa1:

Sequence, based on SEQRES records: (download)

>d3lypa1 c.47.1.0 (A:8-85) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
rlacysdpadhyshrvrivlaekgvsaeiisveagrqppklievnpygslptlvdrdlal
westvvmeylderyphpp

Sequence, based on observed residues (ATOM records): (download)

>d3lypa1 c.47.1.0 (A:8-85) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
rlacysdpadhyshrvrivlaekgvsaeiisveqppklievnpygslptlvdrlalwest
vvmeylderyphpp

SCOPe Domain Coordinates for d3lypa1:

Click to download the PDB-style file with coordinates for d3lypa1.
(The format of our PDB-style files is described here.)

Timeline for d3lypa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lypa2