SCOPe 2.08: Domain d3lypa1: 3lyp A:8-85

Lineage for d3lypa1 (3lyp A:8-85)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:220664] [255947] (2 PDB entries)

8. Domain d3lypa1: 3lyp A:8-85 [265044]
   Other proteins in same PDB: d3lypa2, d3lypb2
   automated match to d3mdkb1

Details for d3lypa1

PDB Entry: 3lyp, 1.6 Å

PDB Description: structure of stringent starvation protein a homolog from pseudomonas fluorescens

PDB Compounds: (A:) stringent starvation protein A

SCOPe Domain Sequences for d3lypa1:

Sequence, based on SEQRES records:

>d3lypa1 c.47.1.0 (A:8-85) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
rlacysdpadhyshrvrivlaekgvsaeiisveagrqppklievnpygslptlvdrdlal
westvvmeylderyphpp

Sequence, based on observed residues (ATOM records):

>d3lypa1 c.47.1.0 (A:8-85) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
rlacysdpadhyshrvrivlaekgvsaeiisveqppklievnpygslptlvdrlalwest
vvmeylderyphpp

Timeline for d3lypa1:

• d3lypa1 first appeared in SCOPe 2.05
  
• d3lypa1 appears in SCOPe 2.07