Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) |
Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
Protein Elongation factor 2 (eEF-2) [82677] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [268003] (1 PDB entry) |
Domain d3j3az4: 3j3a z:742-858 [264918] Other proteins in same PDB: d3j3aa_, d3j3ab_, d3j3ac_, d3j3ad_, d3j3ae_, d3j3af_, d3j3ag_, d3j3az1, d3j3az2, d3j3az5 |
PDB Entry: 3j3a (more details), 5 Å
SCOPe Domain Sequences for d3j3az4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3j3az4 d.58.11.1 (z:742-858) Elongation factor 2 (eEF-2) {Human (Homo sapiens) [TaxId: 9606]} epiylveiqcpeqvvggiygvlnrkrghvfeesqvagtpmfvvkaylpvnesfgftadlr sntggqafpqcvfdhwqilpgdpfdnssrpsqvvaetrkrkglkegipaldnfldkl
Timeline for d3j3az4: